PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g114400.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 133aa    MW: 14869.7 Da    PI: 4.2645
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g114400.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB54.62.6e-172672186
               NF-YB 21 lPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                        lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l al  lGf +y e++ + 
  Solyc03g114400.2.1  2 LPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREDKRTIAPEHVLKALEVLGFGEYTEEVYAA 67
                        8999********************************************************988654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.7E-282112IPR009072Histone-fold
SuperFamilySSF471131.13E-243112IPR009072Histone-fold
PfamPF008084.3E-14452IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MLPPDVRVAR DTQDLLIECC VEFINLISSE SNEVCNREDK RTIAPEHVLK ALEVLGFGEY  60
TEEVYAAYEQ HKLETVDTVR AGKLSNNIAE MTEEEALAAQ QRMFAEARAR MNGVGTVPPK  120
QQDPETEQKL DC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B5e-29410830133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.213731e-121fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236100.11e-94PREDICTED: protein Dr1 homolog
RefseqXP_010318905.11e-94PREDICTED: protein Dr1 homolog
RefseqXP_015067469.13e-94PREDICTED: protein Dr1 homolog isoform X1
RefseqXP_015067470.11e-94PREDICTED: protein Dr1 homolog isoform X2
SwissprotP495922e-66NC2B_ARATH; Protein Dr1 homolog
TrEMBLK4BKU22e-94K4BKU2_SOLLC; Uncharacterized protein
STRINGSolyc03g114400.2.16e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Representative plantOGRP34491727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-69nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]